Web Analysis for Mersindoguakdeniztemsilciligi - mersindoguakdeniztemsilciligi.com
3.32
Rating by CuteStat
mersindoguakdeniztemsilciligi.com is 6 years 1 week old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, mersindoguakdeniztemsilciligi.com is SAFE to browse.
PageSpeed Score
99
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 1 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 94.199.200.87)
Kayseri Evden Eve Nakliyat | Kayseri Ev Taşıma firmaları
- kayserievdenevenakliyatfirmalari.com
Kayseri evden eve nakliyat, sektörü; şehir içi ev taşıma, şehirler arası nakliye hizmetleri sağlayan eşya taşıma ve nakliyat firmalar için tıklayın.
8,137,110
$
240.00
Özcanlar Mermer Granit | Yapı Malzemeleri
- ozcanlarmermergranit.com
Özcanlar Mermer Granit, güler yüzlü hizmet, güven ve kalitenin adresi
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Content-Type: text/html; charset=UTF-8
Content-Length: 362
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Fri, 04 May 2018 21:15:51 GMT
Accept-Ranges: bytes
Connection: close
Content-Type: text/html; charset=UTF-8
Content-Length: 362
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Fri, 04 May 2018 21:15:51 GMT
Accept-Ranges: bytes
Connection: close
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
cpns1.turhost.com | 37.230.110.110 | Türkiye | |
cpns2.turhost.com | 37.230.111.111 | Türkiye |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
mersindoguakdeniztemsilciligi.com | A | 14400 |
IP: 94.199.200.87 |
mersindoguakdeniztemsilciligi.com | NS | 86400 |
Target: cpns1.turdns.com |
mersindoguakdeniztemsilciligi.com | NS | 86400 |
Target: cpns2.turdns.com |
mersindoguakdeniztemsilciligi.com | SOA | 86400 |
MNAME: cpns1.turdns.com RNAME: csf.ofis.net Serial: 2018050303 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
mersindoguakdeniztemsilciligi.com | MX | 14400 |
Target: mersindoguakdeniztemsilciligi.com |
mersindoguakdeniztemsilciligi.com | TXT | 14400 |
TXT: v=spf1 +a +mx +ip4:94.199.200.85 ~all |
Full WHOIS Lookup
Domain Name: MERSINDOGUAKDENIZTEMSILCILIGI.COM
Registry Domain ID: 2259562558_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ihs.com.tr
Registrar URL: http://www.ihs.com.tr
Updated Date: 2018-05-03T14:54:57Z
Creation Date: 2018-05-03T14:11:50Z
Registry Expiry Date: 2019-05-03T14:11:50Z
Registrar: IHS Telekom, Inc.
Registrar IANA ID: 1091
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: CPNS1.TURHOST.COM
Name Server: CPNS2.TURHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-05-04T21:15:38Z
Registry Domain ID: 2259562558_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ihs.com.tr
Registrar URL: http://www.ihs.com.tr
Updated Date: 2018-05-03T14:54:57Z
Creation Date: 2018-05-03T14:11:50Z
Registry Expiry Date: 2019-05-03T14:11:50Z
Registrar: IHS Telekom, Inc.
Registrar IANA ID: 1091
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: CPNS1.TURHOST.COM
Name Server: CPNS2.TURHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-05-04T21:15:38Z